Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens profilin 1 (PFN1), transcript variant 2 (NM_005022). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P07737 |
| Entry Name | PROF1_HUMAN |
| Gene Names | PFN1 |
| Alternative Gene Names | |
| Alternative Protein Names | Profilin-1 (Epididymis tissue protein Li 184a) (Profilin I) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 140 |
| Molecular Weight(Da) | 15054 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY |
Background
| Function | FUNCTION: Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG. Inhibits androgen receptor (AR) and HTT aggregation and binding of G-actin is essential for its inhibition of AR. {ECO:0000269|PubMed:18573880}. |
| Pathway | |
| Protein Families | Profilin family |
| Tissue Specificity | Expressed in epididymis (at protein level). {ECO:0000269|PubMed:20736409}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |